PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA160G00007
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 1336aa    MW: 148943 Da    PI: 8.3285
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA160G00007genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.25.9e-11803844346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT eE e++++  + +G++ +k+Ia++++ ++t  +c+++++k
      AA160G00007 803 PWTSEEREIFLNNLAAYGKD-FKKIASYLP-HKTTADCIDFYYK 844
                      8*****************99.*********.***********98 PP

2Myb_DNA-binding25.82.5e-0810111053347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47  
                        WT +E   +++a+ ++G++ +++I++ +  +R+  qc+ ++ k+
      AA160G00007 1011 HWTDDEKSAFIQAFSLYGKN-FELISSFVR-TRSQDQCRVFFSKV 1053
                       6*****************99.*********.********998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.73E-14787847IPR009057Homeodomain-like
PROSITE profilePS5129315.564799850IPR017884SANT domain
SMARTSM007171.6E-11800848IPR001005SANT/Myb domain
PfamPF002491.0E-8802844IPR001005SANT/Myb domain
CDDcd001678.04E-9803845No hitNo description
Gene3DG3DSA:1.10.10.601.1E-6803845IPR009057Homeodomain-like
PROSITE profilePS5129314.12410071058IPR017884SANT domain
SMARTSM007174.4E-810081056IPR001005SANT/Myb domain
SuperFamilySSF466891.64E-1010091058IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.3E-510101052IPR009057Homeodomain-like
PfamPF002494.6E-710111052IPR001005SANT/Myb domain
CDDcd001677.57E-610121053No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1336 aa     Download sequence    Send to blast
MIPQDHASLD RKDLFRQRKH ERSEQSFDPT LRWRNSPTIP SHLPRWESCD IRRPPGHGQH  60
NGMHQFVEGT NGYPNSRPNA RGFEDDYYRP SAPRGEWRYT RTFRNEKGSF SQKDWKCQTW  120
EMNNGSSRSF DRPCGTKNDR RSVGERPSHT SDSHSAVVSS WDPANYTRQP DTEVCNPVQK  180
LEVGRVHNFK DQRQSLPSDP HSGRIRMCEQ PYSEDKHNDK VCSSANLCLD IKSGQELADD  240
RSLQPSVSHT DPLHLQEPRD NLQHDISGLK MPKQIRKEGL LQSIDWKHPV WTRSETFASQ  300
GSSFSSSSHS KSLGATDSSD QNNKVLPKKN VAVMESPSGD AAVCLTSNYL PEEMISRKKQ  360
RVRWGEGLAK YEKKKIDVNT NDDETTLSIS STEEMCSLNK IPGNKSPTAS CVLDYYTPAT  420
PSSVACSLSL GIIQLIKFIT IMCYRADKST GKATLVPSNA SNLCHSPSPV SSSYLEGFPV  480
NLQEFSNISL DSAGCFLSEL LHTDDLGAGD SSSVQLTAVN KLLTWKGNIL KALETTESEI  540
DLLENEQRMV KVDAKVSEVE KATCVSETMD RTSVHNAFSA NVPVDASEDS PVTVQSLARS  600
AVGVIADGCL TANGENIELS SGDCSVASCE DASCSMILAS NRKSANKASE SLDELLPKAS  660
CFDYSRFSGL CRSEVNSHVK QKVAARRELL RVKEKILLLR YNAFQLSWKK RLDEIPLSKC  720
QPKSQKNFHA EINDHLKDPQ YVHLRLSYPE LLLDSHLRPK RDTLRMPSMI LDVKERVTSK  780
FISSNGLVED PCAVEVERTA INPWTSEERE IFLNNLAAYG KDFKKIASYL PHKTTADCID  840
FYYKNHKADC FGKIKKQNAF VKEGKHTYML APQKKWKRET GATSLDILGV VSAVAANEGK  900
IASTRQISSK QISLRGWSNS RNCNSFERCS YGVDLHRENT VSGNALASGS DTWSSEPIGS  960
SSRTHVGNRE KFLRHQNSDR TVKRLRIAVI TRNDEDDSCS EESGGETGSS HWTDDEKSAF  1020
IQAFSLYGKN FELISSFVRT RSQDQCRVFF SKVRKCLGLE LIPPAKSRNA RTSASGSEGG  1080
GSDLENSCAL ETSNGKNLNS SSSKKSHGKV KDSSSLRLPV DLNKSEEENG RLCLRLENNA  1140
MNVELPNQGC PDFVLEEPSR AFVVGVNKTD ETQREVVGKA MNGTLKLCTK TEEETEGVVL  1200
PKHSCKYEDG ATNRGRNSSL EAEYVHHFGS VAPKPYVVGH NSINGVLELD ERHHRRFGQK  1260
QNGLKKLNVI RTPGMQELNR RSRSKSDVMM NKCNGSVHSR SHSLSLSDTE RSKKTGDIKL  1320
FGTILTSLKN DHKSST
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1356362RKKQRVR
2356374RKKQRVRWGEGLAKYEKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002876132.10.0myb family transcription factor
TrEMBLA0A087GX760.0A0A087GX76_ARAAL; Uncharacterized protein
STRINGscaffold_502292.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52602744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.10.0MYB family protein